PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000260056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 362aa    MW: 37483.9 Da    PI: 6.4026
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000260056genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP110.72e-3475144372
            TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                    +++++++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl+ a+pai+++tg+++ +a +
  MDP0000260056  75 PARRSSKDRHTKVEGRGRRIRMPAVCAARIFQLTRELGHKSDGETIRWLLEHAEPAIIQATGSGTVPAIA 144
                    57899**********************************************************6666632 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.1E-2879146IPR005333Transcription factor, TCP
PROSITE profilePS5136926.60680134IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MKSNQRQSLE ESNELEHGGD SNNTTTSASG PLVADPPATA LTMKEELTDP VQHLDPQGSL  60
SMGIVPVPVS TALKPARRSS KDRHTKVEGR GRRIRMPAVC AARIFQLTRE LGHKSDGETI  120
RWLLEHAEPA IIQATGSGTV PAIAISVGGT LKIPTTSPAR PNGEITEIPN KRKKMRGSTG  180
EFIDAHDQNS LPSGLAPIAP MTYGGGGGGL VPMWQVGATG AAGPFFMFPN SGAIQNQPQL  240
WAIPTADSTA PIFNFQPRPM SDFVSAFQPG VQVGGVSGGD GQLQASSGSM SSGTAAGGGG  300
TCSSSLGHSL DSASGTSAAA AADAPPSSAT QMLRDFSLEI YDKKELQFMG QAANAQTTYS  360
ES
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.245920.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376508.10.0PREDICTED: transcription factor TCP19-like
TrEMBLW9RV441e-118W9RV44_9R
STRINGGLYMA20G29330.21e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.24e-64TCP family protein